Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0316 protein SSP0880 (SSP0880)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0316 protein SSP0880 (SSP0880) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

UPF0316 protein SSP0880

UniProt

Q49YV5

Expression Region

1-192

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVITSNPWLMVLAIFIINVAYVTCLTMRTILTLKGYRYVAAIVSFLEVLVYVVGLGMVM SSLDQIQNVFAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSSEYELDLPRQLRDLGYGVT HNTAYGRDGKRLILQILTPRRFEFKLIDTIKQIDEKAFIVAYEPRQIHGGFWAKGVRSKK LKQYDTDEVESI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Ascorbic Acid-2-13C
TRC-A786994-5MG 5 mg

L-Ascorbic Acid-2-13C

Sign In for Pricing
View Details
MAST3 Human Gene Knockout Kit (CRISPR)
KN419098 1 Kit

MAST3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha-Copaene (>90%)
TRC-C685210-25MG 25 mg

Alpha-Copaene (>90%)

Sign In for Pricing
View Details
Recombinant PML Antibody
RC-15575-01 50 μL

Recombinant PML Antibody

Sign In for Pricing
View Details
Recombinant PML Antibody
RC-15575-02 100 µL

Recombinant PML Antibody

Sign In for Pricing
View Details
Recombinant PML Antibody
RC-15575-03 1 mL

Recombinant PML Antibody

Sign In for Pricing
View Details