Recombinant Rat E3 ubiquitin-protein ligase RNF185 (Rnf185)
This Recombinant Rat E3 ubiquitin-protein ligase RNF185 (Rnf185) spans the amino acid sequence from region 1-192.
Product Specifications
Product Name Alternative
E3 ubiquitin-protein ligase RNF185, EC= 6.3.2.-, RING finger protein 185
UniProt
Q568Y3
Expression Region
1-192
Origin
Rattus norvegicus (Rat)
Field of Research
Molecular Biology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MASKGPSASASTENSSAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCW PCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENR GGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLF VALVIMFWLLIA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470050-500 1x 500 µL
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400460-100 1x 100 µL
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740096-100 1x 100 µL
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details