Recombinant Thermosynechococcus elongatus Photosystem I assembly protein Ycf4 (ycf4)
This Recombinant Thermosynechococcus elongatus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-192.
Product Specifications
Product Name Alternative
Photosystem I assembly protein Ycf4
UniProt
Q8DJ41
Expression Region
1-192
Origin
Thermosynechococcus elongatus (strain BP-1)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTNSPITEPSPRQESVLRYPVLGSRRPSNYFWATAVSIGGLGFFLAGLSSYLHRNLLPIG NPIDLVFIPQGIAIGFYGVAALLLATYLWLAIAWDVGGGFNEFNKETGFVRIFRWGFPGK NRQIEVSCPISDVQAVKIVIKEGLNPKRSLYLKIKGRGEVPLTRVGAPLPLAELETQGAT IASFLGVPVEGL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680860-100 1x 100 µL
Human Lambda Light Chain (Lamb14), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472615-100 1x 100 µL
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC050968-500 1x 500 µL
CD63 (LAMP3/968), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details