Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM210B (FAM210B)

This Recombinant Human Protein FAM210B (FAM210B) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Protein FAM210B

UniProt

Q96KR6

Expression Region

1-192

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGLLALLGPAGRVGARVRPRATWLLGATAPCAPPPLALALLPPRLDARLLRTARGDCRG HQDPSQATGTTGSSVSCTEEKKQSKSQQLKKIFQEYGTVGVSLHIGISLISLGIFYMVVS SGVDMPAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPLIVRYFR KVGFFKPPAAKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details