Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Apoptosis regulator BAX (BAX)

This Recombinant Bovine Apoptosis regulator BAX (BAX) spans the amino acid sequence from region 1-192.

Product Specifications

Product Name Alternative

Apoptosis regulator BAX

UniProt

O02703

Expression Region

1-192

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLS ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perindopril Erbumine
S1506-50mg 50 mg

Perindopril Erbumine

Sign In for Pricing
View Details
Bovine Secreted Frizzled Related Protein 5 (SFRP5) ELISA Kit-Sandwich
EK10F113-01 48 Test

Bovine Secreted Frizzled Related Protein 5 (SFRP5) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Secreted Frizzled Related Protein 5 (SFRP5) ELISA Kit-Sandwich
EK10F113-02 96 Tests

Bovine Secreted Frizzled Related Protein 5 (SFRP5) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Anti-GAL Polyclonal Antibody
TMAB-06276-01 50 μL

Anti-GAL Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GAL Polyclonal Antibody
TMAB-06276-02 100 µL

Anti-GAL Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GAL Polyclonal Antibody
TMAB-06276-03 200 µL

Anti-GAL Polyclonal Antibody

Sign In for Pricing
View Details