Recombinant Triticum timopheevii ATP synthase protein MI25
This Recombinant Triticum timopheevii ATP synthase protein MI25 spans the amino acid sequence from region 1-192.
Product Specifications
Product Name Alternative
ATP synthase protein MI25, ORF25
UniProt
P68537
Expression Region
1-192
Origin
Triticum timopheevii (Timopheev's wheat) (Triticum dicoccon var. timopheevii)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRFLSTDMKDRNMLFAAIPSICASSPKKISIYNEEMIVARCFIGFLIFSRKSLGKTFKET LDGRIESIQEELLQFFNPNEVIPEESNEQQRLLRISLRICSTVVESLPTARCAPKCEKTV QALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVSGSTFKASTIDLIREGL IVLRKVRVGGSI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M3887-10K-HRP 100 µL
MHC Class 2, D, DP (DMA, DMB, DP beta 1, DPB1, DRB, HLA Class II Histocompatibility Antigen DM beta Chain, HLA DMB, HLADM, HLADPB1, Major Histocompatibility Complex Class II (DP beta 1), MHC Class II Antigen DMB, MHC DPB1, RING6, RING7) (HRP) discontinued
Sign In for Pricing
View Details 
HP220903 200 Reactions
LOC126537 Human qPCR Primer Pair (XM_065151)
Sign In for Pricing
View Details 