Recombinant Enterobacteria phage P22 Superinfection exclusion protein B (sieB)
This Recombinant Enterobacteria phage P22 Superinfection exclusion protein B (sieB) spans the amino acid sequence from region 1-192.
Product Specifications
Product Name Alternative
Superinfection exclusion protein B
UniProt
P38396
Expression Region
1-192
Origin
Enterobacteria phage P22 (Bacteriophage P22)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNNSWWQELMRFFLQGMTLKQLIHMLIILIVLIIVMPVSVKEWINLHNPEILPHYWMYYI LLFCVSYVLNGVVNSVYHAVTERIEASTAQRRKDREEKVVRDLFDSLTLGERAYLAFAVA ANNQLKTEKGSPEAISLLKKGIITRLPSAIGYPDIDRFIIPEKYFNECYMRFAGKSDILM NELIVQDEQLKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040994-500 1x 500 µL
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400770-100 1x 100 µL
Cytokeratin 8/18 (C-43 + DC10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881706-500 1x 500 µL
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details