Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Potassium-transporting ATPase C chain (kdpC)

This Recombinant Bacillus cereus Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

B7II10

Expression Region

1-193

Origin

Bacillus cereus (strain G9842)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLI GQNFTDPRYFQGRVSSIEYKAEASGSNNYAPSNPDLEKRVEKSIEEWKKQNRAVPVTEVP IDLVTNSGSGLDPDISPQAASVQVDRISKLTNITKETLNQLIKDQTEGAALGLFGENRVN VLKLNLELQKLLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Recombinant Protein
TP303907L 1 mg

Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Recombinant Protein

Sign In for Pricing
View Details
MDM2 (SMP14), CF488A conjugate, 0.1mg/mL
BNC881721-100 1x 100 µL

MDM2 (SMP14), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IP1 Succinimidyl Ester
20340-AAT 100 µg

IP1 Succinimidyl Ester

Sign In for Pricing
View Details
Aurora C Rabbit polyclonal Antibody
ER1904-04 100 µL

Aurora C Rabbit polyclonal Antibody

Sign In for Pricing
View Details
NCF4 Rabbit Polyclonal Antibody
AP06549PU-N 100 µg

NCF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
14 3 3 eta (YWHAH) Human Gene Knockout Kit (CRISPR)
KN400013 1 Kit

14 3 3 eta (YWHAH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details