Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Potassium-transporting ATPase C chain (kdpC)

This Recombinant Bacillus cereus Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

B7HDG0

Expression Region

1-193

Origin

Bacillus cereus (strain B4264)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLI GQNFTDPRYFQGRVSSIEYKAEASGSNNYAPSNPDLAKRVEKSIADWKEKNPAVPVTEIP IDLVTNSGSGLDPDISPKAASVQVDRISKLTNIPKEKLNQLIKDQTEGAALGLFGETRVN VLKLNLALQKLMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf2 Protein Vector (Human) (pPB-His-GST)
PV330503 500 ng

C21orf2 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
SH2D1A Peptide
orb1233554 0.1 mg

SH2D1A Peptide

Sign In for Pricing
View Details
GPR4 Polyclonal Antibody
orb3149655-01 50 µg

GPR4 Polyclonal Antibody

Sign In for Pricing
View Details
GPR4 Polyclonal Antibody
orb3149655-02 100 µg

GPR4 Polyclonal Antibody

Sign In for Pricing
View Details
PEMT (m) -PR
sc-152162-PR 10 µM - 20 µL

PEMT (m) -PR

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia Argininosuccinate synthase (argG)
MBS1110476-01 0.02 mg (E-Coli)

Recombinant Burkholderia cenocepacia Argininosuccinate synthase (argG)

Sign In for Pricing
View Details