Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Potassium-transporting ATPase C chain (kdpC)

This Recombinant Bacillus cereus Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

B7HWG2

Expression Region

1-193

Origin

Bacillus cereus (strain AH187)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLI GQNFTDPRYFHGRVSSIEYKAEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVP IDLVTNSGSGLDPDISPKAASVQVERISKITNIPKETLNQLIKDQTEGAALGLFGENRVN VLKLNLELQKLMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Type I collagen (from rabbit skin)
TRP-00129 1 mg

Type I collagen (from rabbit skin)

Sign In for Pricing
View Details
Mouse heat shock protein 27,HSP-27 ELISA Kit
CN-02561M1 96T

Mouse heat shock protein 27,HSP-27 ELISA Kit

Sign In for Pricing
View Details
Clusterin (CLU) BioAssayTM ELISA Kit (Human)
024215 96 Tests

Clusterin (CLU) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Nonafluorobutanesulfonic anhydride
285568-01 1 g

Nonafluorobutanesulfonic anhydride

Sign In for Pricing
View Details
Nonafluorobutanesulfonic anhydride
285568-02 2 g

Nonafluorobutanesulfonic anhydride

Sign In for Pricing
View Details
Nonafluorobutanesulfonic anhydride
285568-03 5 g

Nonafluorobutanesulfonic anhydride

Sign In for Pricing
View Details