Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neospora caninum Dense granule protein 2 (DG2)

This Recombinant Neospora caninum Dense granule protein 2 (DG2) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Dense granule protein 2, Antigen Nc14.1, NcDG2

UniProt

Q25540

Expression Region

1-193

Origin

Neospora caninum (Coccidian parasite)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANNRTLARRRRAFSPLTVVMLAVTLVAFMGVPLSSTGAADAADPVESVEANRRGYTSYG EPPVAVGTSEEYVNSSELAGSRDKGNAEAEEEAAEVETDVQPSSVTIDTEERAAPSQVQV QQERMEEADDAPKPVPVRSAVPSTVAKRQQARHRVIGTAVIAAVVAALLWKFSRRRSGAP REGGENENGGEEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal SATB2 Antibody (rSATB2/6929) [DyLight 488]
NBP3-14288G 0.1 mL

Rabbit Monoclonal SATB2 Antibody (rSATB2/6929) [DyLight 488]

Sign In for Pricing
View Details
KIAA0020 CRISPRa sgRNA lentivector (set of three targets)(Human)
25512121 3x 1.0µg DNA

KIAA0020 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CENPE sgRNA CRISPR Lentivector (Human) (Target 2)
K0432003 1.0 µg DNA

CENPE sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Histone H3 (1-8)
CRB1000265-01 0.5 mg

Histone H3 (1-8)

Sign In for Pricing
View Details
Histone H3 (1-8)
CRB1000265-02 1 mg

Histone H3 (1-8)

Sign In for Pricing
View Details
HBP1 Antibody
AF7632-01 50 µL

HBP1 Antibody

Sign In for Pricing
View Details