Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Jannaschia sp. ATP synthase subunit b' (atpG)

This Recombinant Jannaschia sp. ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

Q28UC6

Expression Region

1-193

Origin

Jannaschia sp. (strain CCS1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADEAETLDAAHGATDAAHGAADAAHASSPGMPQLDFATFPNQIFWLVLTLLAIYFVLTK IALPRISSVIAERQGTLTNDLAAAEDLKRQAAEAEESYNTALANARAEASRIAQETRDEI QAQTQVEIDKADAQIAARTAEGEARIAEIEAGAIATAEEVARDVATEIVRAFGPGQDVDA AAVADAVANRVRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (KRT7) (NM_005556) Human 3' UTR Clone
SC202509 10 µg

Cytokeratin 7 (KRT7) (NM_005556) Human 3' UTR Clone

Sign In for Pricing
View Details
FGF4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0777308 1.0 µg DNA

FGF4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Monkey ADCY1 ELISA Kit
EMKA0494 96 Tests

Monkey ADCY1 ELISA Kit

Sign In for Pricing
View Details
Bovine Apoptosis enhancing nuclease (AEN) ELISA kit
GTR10399960 96 Well

Bovine Apoptosis enhancing nuclease (AEN) ELISA kit

Sign In for Pricing
View Details
RELL2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38805064 1.0 µg DNA

RELL2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Cep70 (NM_001017470) Rat Tagged ORF Clone Lentiviral Particle
RR200538L4V 200 µL

Cep70 (NM_001017470) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details