Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Selenoprotein S A (sels-a)

This Recombinant Xenopus laevis Selenoprotein S A (sels-a) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Selenoprotein S A, SelS A

UniProt

Q6AZH0

Expression Region

1-193

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELGNQPGPGNRPEIELEWYQYVQNTVGWALASYGWYILFGCIILYFLIQKLSANFTRAG ASTHTTVTDPDEIVRRQEAVTAARMRMQEELNAQAELYKQKQVQLQEEKRRRNIETWDRM QEGKSSKVACRLGQDASPSTSASSSPSTSSSAPKPKPERKPLRGSGYNPLTGDGGSTCAW RPGRRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-100 1x 100 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL
BNC880788-100 1x 100 µL

MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3), CF488A conjugate, 0.1mg/mL
BNC880049-100 1x 100 µL

CD31 / PECAM-1 (C31.3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details