Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)

This Recombinant Candida glabrata Mitochondrial import inner membrane translocase subunit TIM22 (TIM22) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM22

UniProt

Q6FT37

Expression Region

1-193

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVYRGFGLEYLSPPEKKAFGELSPDEQGERGAEMVVGFMSSCPGKSVISGATGFALGGVL GLFMASMAYDTPLHTPVPGGMSGAVQQMADLPLRQQVKLQFADMGKRAYSSAKNFGYIGM IYAGVECAVESLRAKNDIYNGITAGCITGGGLAYKSGPQAALVGCAGFAAFSAAIDMYMK SEDGRPPENDFKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacteriophage Shiga-like toxin 2 subunit B Protein, His, Yeast-1mg
QP7305-ye-1mg 1mg

Recombinant Bacteriophage Shiga-like toxin 2 subunit B Protein, His, Yeast-1mg

Sign In for Pricing
View Details
Anti-human SLC1A5 / ASCT2 (Idactamab Biosimilar)
BIO0284SM-20mg 20 mg

Anti-human SLC1A5 / ASCT2 (Idactamab Biosimilar)

Sign In for Pricing
View Details
Synemin (SYNM) Antibody
abx333909-01 20 µg

Synemin (SYNM) Antibody

Sign In for Pricing
View Details
Synemin (SYNM) Antibody
abx333909-02 50 µg

Synemin (SYNM) Antibody

Sign In for Pricing
View Details
Synemin (SYNM) Antibody
abx333909-03 100 µg

Synemin (SYNM) Antibody

Sign In for Pricing
View Details
Synemin (SYNM) Antibody
abx333909-04 200 µg

Synemin (SYNM) Antibody

Sign In for Pricing
View Details