Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q7VB45

Expression Region

1-193

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSADFKEASSPTDSSETLLEQIVKGSRKTSNYIVASMLAVGGIGFSLASLSSYFGIDLLP LGNPSTLIFVPQGLFMGFYGIAATFISVYLWALIKVDYGSGLNRFDKNKGVLSVSRKGLL KEILVEIPIDDIQAVKLEVREGFNPRRRITLRLQGRRDLPISEVGGPQPLLSLEQEGAEI ARFLKVNLEGLSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2169170-01 0.1 mL

FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2169170-02 0.2 mL

FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2169170-03 0.5 mL

FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2169170-04 1 mL

FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2169170-05 5 mL

FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2169170-06 5x 5 mL

FITC-Linked Monoclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details