Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Potassium-transporting ATPase C chain (kdpC)

This Recombinant Bacillus cereus Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

Q81HP9

Expression Region

1-193

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLI GQNFTDPRYFQGRVSSIEYKAEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVP IDLVTNSGSGLDPDISPKAASVQVDRISKLTDIPKEKLNQLIKDQTEGAALGLFGETRVN VLKLNLALQELMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chic2 3'UTR Lenti-reporter-Luc Vector
16069086 1.0 µg

Chic2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
OR1A1 Rabbit pAb
E45R23044N 50 ul

OR1A1 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Laminin Gamma 2 (LAMC2)
MBS2029945-01 0.01 mg

Recombinant Laminin Gamma 2 (LAMC2)

Sign In for Pricing
View Details
Recombinant Laminin Gamma 2 (LAMC2)
MBS2029945-02 0.05 mg

Recombinant Laminin Gamma 2 (LAMC2)

Sign In for Pricing
View Details
Recombinant Laminin Gamma 2 (LAMC2)
MBS2029945-03 0.1 mg

Recombinant Laminin Gamma 2 (LAMC2)

Sign In for Pricing
View Details
Recombinant Laminin Gamma 2 (LAMC2)
MBS2029945-04 0.2 mg

Recombinant Laminin Gamma 2 (LAMC2)

Sign In for Pricing
View Details