Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Potassium-transporting ATPase C chain (kdpC)

This Recombinant Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

Q81UW5

Expression Region

1-193

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLI GQNFTDPRYFHGRVSSIEYKAEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVP IDLVTNSGSGLDPDISPKAASVQVERISKLTNIPKETLDQLIKDQTEGAALGLFGETRVN VLKLNLGLQKIMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAK antibody - N-terminal region (ARP55278_P050)
ARP55278_P050 100 µL

DAK antibody - N-terminal region (ARP55278_P050)

Sign In for Pricing
View Details
Bovine Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) ELISA Kit
MBS285934-01 48 Tests

Bovine Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) ELISA Kit
MBS285934-02 96 Tests

Bovine Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) ELISA Kit
MBS285934-03 5x 96 Tests

Bovine Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) ELISA Kit
MBS285934-04 10x 96 Tests

Bovine Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) ELISA Kit

Sign In for Pricing
View Details
Monarch Spin Columns S2B and Tubes
T2057L 100 Preparations

Monarch Spin Columns S2B and Tubes

Sign In for Pricing
View Details