Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HERV-K_16p3.3 provirus ancestral Env polyprotein

This Recombinant Human HERV-K_16p3.3 provirus ancestral Env polyprotein spans the amino acid sequence from region 290-482.

Product Specifications

Product Name Alternative

HERV-K_16p3.3 provirus ancestral Env polyprotein, Envelope polyprotein, Cleaved into the following 2 chains:, 1. Surface protein, 2. SU, 3. Transmembrane protein, 4. TM

UniProt

Q9NX77

Expression Region

290-482

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FIFTLIAVLAGLLAVTATAATAGVAIRSSVQTAHYVEACQKNSSRLWNSQAQIDQKLANQ INDLRQSVTWLGDRVMNLQHRMQLQCDWNTSDYCITPYAYNQDQHSWENVSRHLKAWDDN LTLDISQLKEQIFEASQAHLSTVPGSHIFEGITKQLPDFNPFKWLKPVRGSLLLLALLIL VCLCCLLLVCRCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-500 1x 500 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-500 1x 500 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF740 conjugate, 0.1mg/mL
BNC741773-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1773R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details