Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0226.1 (MJ0226.1)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0226.1 (MJ0226.1) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0226.1

UniProt

P81304

Expression Region

1-193

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIELILLIVVLFLTPYLIALFIIFNPPYCILDYLLYKKYRKAKEEWHYITSTNMGMNRS RWIFILIVEIIALCSGFYILININRPHDEILTFSLIFLFIAIIYDKLTPASGTVEIYKEG IAVYIKIFNTLKPFLNRYIVLPWKFFKGYKIKSKNNTKYVILVPKSRLFFSIYLIDRDGN VEKTIRNHLNPIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-500 1x 500 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-500 1x 500 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-100 1x 100 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF647 conjugate, 0.1mg/mL
BNC472010-500 1x 500 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX6 (PAX6/498), CF647 conjugate, 0.1mg/mL
BNC470498-100 1x 100 µL

PAX6 (PAX6/498), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details