Recombinant Bovine SAYSvFN domain-containing protein 1 (SAYSD1)
This Recombinant Bovine SAYSvFN domain-containing protein 1 (SAYSD1) spans the amino acid sequence from region 1-194.
Product Specifications
Product Name Alternative
SAYSvFN domain-containing protein 1
UniProt
Q32L85
Expression Region
1-194
Origin
Bos taurus (Bovine)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEQRLAEFRAARKRAGLVAEPSASSQSTQTSGEKAEAATTPKAPSGWLKRFLVWKPRPPS AQAQPSLAQGAAWPRGLESQPPWSPAEEAPPPPQPPPPQPLTPRDRSLLTSVTLLKVLLW LVLLGLFVELEFGLAYFVLSLFYWMYVGMRGPEEKMQGEKSAYSVFNPGCEAIQGSLTAE QLERELHLRPLPRR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details