Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Potassium-transporting ATPase C chain (kdpC)

This Recombinant Salmonella typhimurium Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

Q8ZQW3

Expression Region

1-194

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIGLRPAFSTMLFLLLLTGGVYPLLTTALGQWWFPWQANGSLIHKDNVIRGSALIGQSFT AAGYFHGRPSATADTPYNPLASGGSNLAASNPELDAQIQARVAALRAANPQASSAVPVEL ATASASGLDNNLTPGAAAWQIPRVAAARQLPVEQVAQLVAEYTHRPLARFLGQPVVNIVE LNLALDALQGHRAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-100 1x 100 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-500 1x 500 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-500 1x 500 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details