Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 84 protein (mug84)

This Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 84 protein (mug84) spans the amino acid sequence from region 1-195.

Product Specifications

Product Name Alternative

Meiotically up-regulated gene 84 protein

UniProt

O13904

Expression Region

1-195

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLTHHSTFIKGIEGSAEGEIEDVRQTTVFDPPFYGHPMLVPPSPSLTTMFRTRSTTPDE EGTAIAEIDQQDWDIMVKVPTYEYYGFVMYLVSMLGFGVYIVWALTPAPVLKFFEIHYYL SRWWALAIPTWLFVLVIYIHVVLNAYNTEVLTKPFSSLECIVDQYALVGEEDGAAHGRVV DLRLCDVNKQQLEET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-100 1x 100 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IDH1 (IDH1/1152), CF594 conjugate, 0.1mg/mL
BNC941152-100 1x 100 µL

IDH1 (IDH1/1152), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF405S conjugate, 0.1mg/mL
BNC041991-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1991), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF405S conjugate, 0.1mg/mL
BNC042958-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF640R conjugate, 0.1mg/mL
BNC402153-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details