Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0924 (AF_0924)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0924 (AF_0924) spans the amino acid sequence from region 1-195.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0924

UniProt

O29338

Expression Region

1-195

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVKFIKKSESVIGLWLPILVILILFAFLVAESVIMKDIILSNSVVALATAIMASAALV TILVSNRQVQLMARQQRLKAIEDRLEKFYIPLIKAFSSYVYTAQTEDEIETIITCRRYLA GNNLLRVLPMHFKFKADKIAGSANWTFYAKEDFEQWKEALDVLWEEFLEVLKEYYTLSGT EISLPEKPDWLIGYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF568 conjugate, 0.1mg/mL
BNC682427-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/155), CF405S conjugate, 0.1mg/mL
BNC040155-100 1x 100 µL

CD19 (CVID3/155), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details