Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azorhizobium caulinodans ATP synthase subunit b/b' (atpG)

This Recombinant Azorhizobium caulinodans ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'

UniProt

A8HT70

Expression Region

1-196

Origin

Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVAQAGAPAHPPAAHGAEAGHGEAAGGEHGGFPPFKPQHFASQLIWLIVSFGALYFLMS RVTLPRIGRILEERHDRIAKDLEEARLRQAESEAAQAAYEKALTEARGKANAIAGEARAR LAAETDANRKSLEENLNAKLADAERRIASTKATALSHVRGIAVDTTGAIVTALVGTPAGN QDVESAVDAALAAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YB1 (YBX1) Human Gene Knockout Kit (CRISPR)
KN209835BN 1 Kit

YB1 (YBX1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD44 Standard (156-3C11), Biotin conjugate, 0.1mg/mL
BNCB0460-500 1x 500 µL

CD44 Standard (156-3C11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant alpha Actinin 4 Antibody
RC-4161-01 50 μL

Recombinant alpha Actinin 4 Antibody

Sign In for Pricing
View Details
Recombinant alpha Actinin 4 Antibody
RC-4161-02 100 µL

Recombinant alpha Actinin 4 Antibody

Sign In for Pricing
View Details
Recombinant alpha Actinin 4 Antibody
RC-4161-03 1 mL

Recombinant alpha Actinin 4 Antibody

Sign In for Pricing
View Details
NCKAP1 Rabbit Polyclonal Antibody
TA367145 100 µL

NCKAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details