Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azorhizobium caulinodans ATP synthase subunit b/b' (atpG)

This Recombinant Azorhizobium caulinodans ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'

UniProt

A8HT70

Expression Region

1-196

Origin

Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVAQAGAPAHPPAAHGAEAGHGEAAGGEHGGFPPFKPQHFASQLIWLIVSFGALYFLMS RVTLPRIGRILEERHDRIAKDLEEARLRQAESEAAQAAYEKALTEARGKANAIAGEARAR LAAETDANRKSLEENLNAKLADAERRIASTKATALSHVRGIAVDTTGAIVTALVGTPAGN QDVESAVDAALAAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein
TP306100M 100 µg

Meis homeobox 3 (MEIS3) (NM_020160) Human Recombinant Protein

Sign In for Pricing
View Details
Aip Mouse Gene Knockout Kit (CRISPR)
KN501047 1 Kit

Aip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
mTOR Rabbit Polyclonal Antibody
HA500126 100 µL

mTOR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PNLDC1 activation kit by CRISPRa
GA115887 1 Kit

Human PNLDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Clofentezine-d8
TRC-C585616-1MG 1 mg

Clofentezine-d8

Sign In for Pricing
View Details
Human TACO1 activation kit by CRISPRa
GA109648 1 Kit

Human TACO1 activation kit by CRISPRa

Sign In for Pricing
View Details