Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 90A, mitochondrial (ccdc90a)

This Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 90A, mitochondrial (ccdc90a) spans the amino acid sequence from region 67-262.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 90A, mitochondrial

UniProt

Q0P4J6

Expression Region

67-262

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YFFDTHAVVQLLEANGFSAEQSEIVVSALVKILNVNMNLIHKDMVTKEQQEISLQQVMSL IASVKKDMIILEKSEFSALRTQNEKVKIELQQLKKQLNDSIVKVRASNKLDFNLEKSRVK EMHADNERKLLELRTSIVELHSQQDRGLTQTKRKIDTEVSGVKTMQESHKLDTIKYLAGS VFTCLTIALGFYRLWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5 + CGA414), CF568 conjugate, 0.1mg/mL
BNC681223-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5 + CGA414), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF640R conjugate, 0.1mg/mL
BNC402227-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2423), CF594 conjugate, 0.1mg/mL
BNC942423-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2423), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF405S conjugate, 0.1mg/mL
BNC042554-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details