What is the catalog number for Recombinant Aspergillus oryzae Protein get1 (get1)?

The catalog number for Recombinant Aspergillus oryzae Protein get1 (get1) is orb2929536.

What sizes are available for Recombinant Aspergillus oryzae Protein get1 (get1)?

Recombinant Aspergillus oryzae Protein get1 (get1) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Aspergillus oryzae Protein get1 (get1) come in?

Recombinant Aspergillus oryzae Protein get1 (get1) is available in 2 different pack sizes.

Is Recombinant Aspergillus oryzae Protein get1 (get1) in stock?

Recombinant Aspergillus oryzae Protein get1 (get1) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Aspergillus oryzae Protein get1 (get1)

This Recombinant Aspergillus oryzae Protein get1 (get1) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Protein get1, Guided entry of tail-anchored proteins 1

UniProt

Q2UG70

Expression Region

1-196

Origin

Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSLIWTIFFLHVAIYVVNTAGASTIDSLLWLLYLKLPTSTSKNAREQSRLKREALELKR DMNNTSSQDEFAKWAKLRRRHDKTMDEYEQLNKTLTAQKSSFDWSVKIARWLSTNGLKIF LQFWYSKTPVFALPEAWIPYYVQWILSFPRAPMGSVSVHVWNSVCATAVSVTAEMVTSMF LQTARPTPVATAQKTQ