Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein RER1 (Rer1)

This Recombinant Rat Protein RER1 (Rer1) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Protein RER1

UniProt

Q498C8

Expression Region

1-196

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEGDSVGDSVHGKPSVVYRFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK FWHAATKGILVAMICTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRRYKGKEDVGKTFAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF2 Protein Vector (Human) (pPM-C-His)
PV051088 500 ng

CSF2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human FAM178B Protein Lysate
MBS8411440-01 0.02 mg

Human FAM178B Protein Lysate

Sign In for Pricing
View Details
Human FAM178B Protein Lysate
MBS8411440-02 5x 0.02 mg

Human FAM178B Protein Lysate

Sign In for Pricing
View Details
P14ARF (4C6/4), CF740 conjugate, 0.1mg/mL
BNC742088-500 1x 500 µL

P14ARF (4C6/4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZHX2 (Zinc Fingers and Homeoboxes Protein 2, Zinc Fingers and Homeoboxes 2)
496080 100 µL

ZHX2 (Zinc Fingers and Homeoboxes Protein 2, Zinc Fingers and Homeoboxes 2)

Sign In for Pricing
View Details
SyntabuLin (SYBU) (NM_001099756) Human Tagged ORF Clone Lentiviral Particle
RC218498L3V 200 µL

SyntabuLin (SYBU) (NM_001099756) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details