Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Theropithecus gelada Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1)

This Recombinant Theropithecus gelada Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) spans the amino acid sequence from region 79-274.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit Rieske, mitochondrial, EC= 1.10.2.2, Complex III subunit 5, Cytochrome b-c1 complex subunit 5, Rieske iron-sulfur protein, RISP, Ubiquinol-cytoc

UniProt

Q69BK2

Expression Region

79-274

Origin

Theropithecus gelada (Gelada baboon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SHTDVKVPDFYDYRRLEVLDSTKSSRESSEARKGFSYLVTAVTTVGVAYAAKNAVTQFIS SMSASADVLAMAKIEINLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDP QHDLDRVKKPEWVILIGICTHLGCVPIANAGDFGGYYCPCHGSHYDVSGRIRLGPAPLNL EVPPYEFTSDDMVVVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit
MBS2514741-01 24 Tests

Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit

Sign In for Pricing
View Details
Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit
MBS2514741-02 48 Test

Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit

Sign In for Pricing
View Details
Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit
MBS2514741-03 96 Tests

Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit

Sign In for Pricing
View Details
Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit
MBS2514741-04 5x 96 Tests

Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit

Sign In for Pricing
View Details
Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit
MBS2514741-05 10x 96 Tests

Human GSTalpha4 (Glutathione S Transferase Alpha 4) ELISA Kit

Sign In for Pricing
View Details
Chicken Hexokinase 1 ELISA Kit
MBS032203 Inquire

Chicken Hexokinase 1 ELISA Kit

Sign In for Pricing
View Details