Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Peroxisome assembly protein 22 (PEX22)

This Recombinant Debaryomyces hansenii Peroxisome assembly protein 22 (PEX22) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Peroxisome assembly protein 22, Peroxin-22

UniProt

Q6BMZ7

Expression Region

1-196

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQAQIRKTQRNPKLWIAALVAASIVTISYKVYSSYIAEENIEDKKTEGDGGVEEKLRIA KRYTKKSIALTLSHSVLSSQLPLNEILLNSENVTFILPPNLSMDDLVCNIGNADEVERYN LPKTLLNNYKLLHCSNIDGYFNILKNLKPDTLLVCSEDLGIANNVPRDLHRFVKEIINID QNKDDIYKKLSSIFIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XAB1 (GPN1) (C-term) Rabbit Polyclonal Antibody
AP51915PU-N 400 µL

XAB1 (GPN1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Hydroxyindole O-b-D-Glucuronide Sodium Salt
TRC-H943443-25MG 25 mg

4-Hydroxyindole O-b-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details
GPR18 (NM_001098200) Human Over-expression Lysate
LC420549 20 µg

GPR18 (NM_001098200) Human Over-expression Lysate

Sign In for Pricing
View Details
D-64131
TRC-D826510-250MG 250 mg

D-64131

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS641367 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Formyl Polystyrene
H50056007.25G 25 g

Formyl Polystyrene

Sign In for Pricing
View Details