Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hylobates syndactylus Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1)

This Recombinant Hylobates syndactylus Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) spans the amino acid sequence from region 79-274.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit Rieske, mitochondrial, EC= 1.10.2.2, Complex III subunit 5, Cytochrome b-c1 complex subunit 5, Rieske iron-sulfur protein, RISP, Ubiquinol-cytoc

UniProt

Q69BJ6

Expression Region

79-274

Origin

Hylobates syndactylus (Siamang) (Symphalangus syndactylus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SHTDVKVPDFSEYRRPEVLDSTKSSRESSEARKGFSYLVTAVTTVGVAYAAKNAVTQFVS SMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDP QHDLDRVKRPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNL EVPTYEFTSDDMVIVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-100 1x 100 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), CF594 conjugate, 0.1mg/mL
BNC941014-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1739), CF740 conjugate, 0.1mg/mL
BNC741739-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/1739), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (CD30/412), CF640R conjugate, 0.1mg/mL
BNC400412-500 1x 500 µL

CD30 (CD30/412), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details