Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein RER1 (RER1)

This Recombinant Chicken Protein RER1 (RER1) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Protein RER1

UniProt

Q5ZHM5

Expression Region

1-196

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEGDSIGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWIVTLGLSFIYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTRQNEEFRPFIRRLPEFK FWHSATKGILVAMACTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRKYKGKEDVGKTFAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Irf1 (NM_001159393) Mouse Tagged ORF Clone Lentiviral Particle
MR225565L4V 200 µL

Irf1 (NM_001159393) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)
MBS1288267-01 0.02 mg (E-Coli)

Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)
MBS1288267-02 0.02 mg (Yeast)

Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)
MBS1288267-03 0.1 mg (E-Coli)

Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)
MBS1288267-04 0.1 mg (Yeast)

Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)
MBS1288267-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus haemolyticus Probable endonuclease 4 (nfo)

Sign In for Pricing
View Details