Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 Uncharacterized gene 27 protein (27)

This Recombinant Equine herpesvirus 2 Uncharacterized gene 27 protein (27) spans the amino acid sequence from region 1-197.

Product Specifications

Product Name Alternative

Uncharacterized gene 27 protein

UniProt

Q66630

Expression Region

1-197

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNILKVTRFDDGTVQEVVHRDGLRVETYYKSEEGEARANLEQRPPAAADEARTYLSPSS SFSSSSSSSSAVALGARPDLAQGGGRGSERRERGCRWNGCPPLAIVLPVLANLIMCAMLA WYLNPLFSPWVYFNCTNSSLGVGNCSNFFGCSRGNLSVNDSFWPPGSVVFGKDGCAVSAS VLGLVGPGVLCNGTGCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RABL2B (NM_001130923) Human Over-expression Lysate
LY427313 100 µg

RABL2B (NM_001130923) Human Over-expression Lysate

Sign In for Pricing
View Details
Clenisopenterol Hydrochloride
TRC-C572700-5MG 5 mg

Clenisopenterol Hydrochloride

Sign In for Pricing
View Details
Phosphoric Acid Tributyl Ester
TRC-P359445-5G 5 g

Phosphoric Acid Tributyl Ester

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS708846 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right middle lobe
CS648048 5x 5 µm

Frozen Tissue Sections, Lung: right middle lobe

Sign In for Pricing
View Details
TCP11 (NM_001093728) Human Over-expression Lysate
LC420682 20 µg

TCP11 (NM_001093728) Human Over-expression Lysate

Sign In for Pricing
View Details