Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 Uncharacterized gene 27 protein (27)

This Recombinant Equine herpesvirus 2 Uncharacterized gene 27 protein (27) spans the amino acid sequence from region 1-197.

Product Specifications

Product Name Alternative

Uncharacterized gene 27 protein

UniProt

Q66630

Expression Region

1-197

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNILKVTRFDDGTVQEVVHRDGLRVETYYKSEEGEARANLEQRPPAAADEARTYLSPSS SFSSSSSSSSAVALGARPDLAQGGGRGSERRERGCRWNGCPPLAIVLPVLANLIMCAMLA WYLNPLFSPWVYFNCTNSSLGVGNCSNFFGCSRGNLSVNDSFWPPGSVVFGKDGCAVSAS VLGLVGPGVLCNGTGCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FGL1 Protein (mFc Tag)
PKSH033679-01 10 µg

Recombinant Human FGL1 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human FGL1 Protein (mFc Tag)
PKSH033679-02 50 µg

Recombinant Human FGL1 Protein (mFc Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS501096 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF568 conjugate, 0.1mg/mL
BNC682117-100 1x 100 µL

ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Chloro-1,2-benzisothiazol-3(2H)-one
TRC-C364620-250MG 250 mg

5-Chloro-1,2-benzisothiazol-3(2H)-one

Sign In for Pricing
View Details
Ascc1 Mouse Gene Knockout Kit (CRISPR)
KN501665 1 Kit

Ascc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details