Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio TM2 domain-containing protein 2 (tm2d2)

This Recombinant Danio rerio TM2 domain-containing protein 2 (tm2d2) spans the amino acid sequence from region 33-229.

Product Specifications

Product Name Alternative

TM2 domain-containing protein 2

UniProt

Q6DHN3

Expression Region

33-229

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QNSTEPPGNRVTTSKPVLFSEQPEENVTESGSVIPTETSNHTEQYEYNPPSPVVLCRYLP EEFIFCQDPVDHGGNVSAFQELGYGCVKFGGQVYKDVNHTQVLCTALDGIECAGPREFLR GNEPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILL ITGGLTPSDSSNWCTFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Thioguanosine
TRC-T350788-2MG 2 mg

8-Thioguanosine

Sign In for Pricing
View Details
ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI3G4]
CF810207 100 µg

ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI3G4]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS802872 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1H3]
CF804230 100 µg

PRAK (MAPKAPK5) Mouse Monoclonal Antibody [Clone ID: OTI1H3]

Sign In for Pricing
View Details
Muromonab Biosimilar - Research Grade
ICH5024-50mg 50 mg

Muromonab Biosimilar - Research Grade

Sign In for Pricing
View Details
2,5,6-Triaminopyrimidin-4(1H)-one Sulphate
TRC-T896540-5G 5 g

2,5,6-Triaminopyrimidin-4(1H)-one Sulphate

Sign In for Pricing
View Details