Recombinant Candida glabrata Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)
This Recombinant Candida glabrata Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 34-230.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39
UniProt
Q6FJ31
Expression Region
34-230
Origin
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
ATAPRNDGGELPSIKKLLMIGLAGTAVFVLAVNSLDKQQPKNSYSESEFESLQRLKRKVA LFPGNQLKVYGVLGTEKYNKIVSGGKIVDPRKIIEKHRTTAGDRYEALLNILYDKYGAVE YFDMLPQGLMVKLVSLYMKDNCSEGDTVVILDFPKSIKDASQFETEVAGISKFIVSQKLK DTDICKYYDAVGKLESV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681041-100 1x 100 µL
TRIM29 (TRIM29/1041), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402685-100 1x 100 µL
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details