Recombinant Human Uncharacterized protein C19orf75 (C19orf75)
This Recombinant Human Uncharacterized protein C19orf75 (C19orf75) spans the amino acid sequence from region 1-197.
Product Specifications
Product Name Alternative
Uncharacterized protein C19orf75
UniProt
Q8N7X8
Expression Region
1-197
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLPLLQLVPAKLLNSSCSLEKTLQCSCSFHGIPTPSVQWWMGGVPVGVDGMDGSLQVTST MLGPWANSTISLTEEPEMGMRLLCEGKNQNGTHALSILLMSRKSSLAAQAFVKGLIQGAI YAGIVIALLFLCLLPLIVKHIRKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVV ATFSESRILEKQDKRAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
041265-APC 200 µL
RPS6KC1, NT (RPS6KC1, RPK118, Ribosomal protein S6 kinase delta-1, 52kD ribosomal protein S6 kinase, Ribosomal S6 kinase-like protein with two PSK domains 118kD protein, SPHK1-binding protein) (APC) discontinued
Sign In for Pricing
View Details 037619 200 µL
KRT36, NT (KRT36, HHA6, HKA6, KRTHA6, Keratin, type I cuticular Ha6, Hair keratin, type I Ha6, Keratin-36)
Sign In for Pricing
View Details MBS1159110-01 0.05 mg (E-Coli)
Recombinant Lymnaea stagnalis Lymna-DF-amide 5
Sign In for Pricing
View Details