Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caulobacter crescentus Potassium-transporting ATPase C chain (kdpC)

This Recombinant Caulobacter crescentus Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-197.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

Q9A7X6

Expression Region

1-197

Origin

Caulobacter crescentus (strain ATCC 19089 / CB15)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSHLRPALVSMGLFTVLLGLAYPLAVTGVAQAAFPNQANGSLIRDADGKVVGSALIGQV FAKPEYFHGRPSAAGAGYDASASSGSNMGPLNETLIARLKTDAAALRAENPGVAIPADAV TTSGSGLDPDISPANARFQAPRVAGARGVPEKDVTALIDAQVQQPLLGFIGQPRVNVLAL NRALDARYPPLASQKDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Ethyl-N-(2-hydroxyethyl)perfluorooctanesulfonamide Phosphate Diester
TRC-E678835-250MG 250 mg

N-Ethyl-N-(2-hydroxyethyl)perfluorooctanesulfonamide Phosphate Diester

Sign In for Pricing
View Details
Mouse F9 Antibody Pair Set
E-KAB-0311 50 µL & 100 µg

Mouse F9 Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast, right
CB547743 1 Block

Frozen Tissue Blocks, Breast, right

Sign In for Pricing
View Details
Fimasartan
TRC-F342040-250MG 250 mg

Fimasartan

Sign In for Pricing
View Details
LysoViewTM 640, 1000X in DMSO, Trial Size
#70085-T 1x 10 µL

LysoViewTM 640, 1000X in DMSO, Trial Size

Sign In for Pricing
View Details
PTau231 Antibody
KC-44542-01 50 μL

PTau231 Antibody

Sign In for Pricing
View Details