Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia alni ATP synthase subunit b (atpF)

This Recombinant Frankia alni ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q0RDB0

Expression Region

1-198

Origin

Frankia alni (strain ACN14a)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASAAILLAASESGHSDENVLIPPLSELLIGTLAFGLLVAFFFWKIRPQIARTYAQRTE RIEGGIARAEAAQREAQALLEQYRAQLTEARAEAARIRDDAHTEGRQIVEELRASAQREI AEIKERADAQLAADRAQIVAQVRREVGVIAIDLASKIVGYQVESTATQARLVDDFIAALD NSAEGAGSSTPAPVGSGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF740 conjugate, 0.1mg/mL
BNC742659-100 1x 100 µL

Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF594 conjugate, 0.1mg/mL
BNC941857-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details