Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Anabaena variabilis Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q3MDS1

Expression Region

1-198

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTASTTINKGDSPNGDSSASSVLHQKVLGSRRFSNYWWASIVTLGASGFLLAGISSYLKV NLLIVTDPTQLIFVPQGLVMGLYGTAGLLLASYLWLAILWDLGGGYNDFNRETGNIKIFR WGFPGKNRKIEIGSRIQDIQSVRIDIKEGLNPRRALYLRVKGRRDIPLTRVGQPLSLAEL ETQGAQLARFLGVPLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP2 Antibody
KC-2624-01 50 μL

MMP2 Antibody

Sign In for Pricing
View Details
MMP2 Antibody
KC-2624-02 100 µL

MMP2 Antibody

Sign In for Pricing
View Details
MMP2 Antibody
KC-2624-03 1 mL

MMP2 Antibody

Sign In for Pricing
View Details
ELK3 (NM_005230) Human Over-expression Lysate
LC401602 20 µg

ELK3 (NM_005230) Human Over-expression Lysate

Sign In for Pricing
View Details
Amplite® Fluorimetric Monoamine Oxidase Assay Kit *Red Fluorescence*
11303-AAT 200 Tests

Amplite® Fluorimetric Monoamine Oxidase Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
ZNF674 (N-term) Rabbit Polyclonal Antibody
AP54710PU-N 400 µL

ZNF674 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details