Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Anabaena variabilis Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q3MDS1

Expression Region

1-198

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTASTTINKGDSPNGDSSASSVLHQKVLGSRRFSNYWWASIVTLGASGFLLAGISSYLKV NLLIVTDPTQLIFVPQGLVMGLYGTAGLLLASYLWLAILWDLGGGYNDFNRETGNIKIFR WGFPGKNRKIEIGSRIQDIQSVRIDIKEGLNPRRALYLRVKGRRDIPLTRVGQPLSLAEL ETQGAQLARFLGVPLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS804821 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Birc3 Mouse Gene Knockout Kit (CRISPR)
KN502171 1 Kit

Birc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF647 conjugate, 0.1mg/mL
BNC472939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIOX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F8]
TA501424BM 100 µL

MIOX Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F8]

Sign In for Pricing
View Details
Biliverdin Reductase (BLVRA) Rabbit Polyclonal Antibody
TA365522 100 µL

Biliverdin Reductase (BLVRA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL18R1/CD218a Protein (His & Fc Tag)
PKSM040868 100 µg

Recombinant Mouse IL18R1/CD218a Protein (His & Fc Tag)

Sign In for Pricing
View Details