Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Anabaena variabilis Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q3MDS1

Expression Region

1-198

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTASTTINKGDSPNGDSSASSVLHQKVLGSRRFSNYWWASIVTLGASGFLLAGISSYLKV NLLIVTDPTQLIFVPQGLVMGLYGTAGLLLASYLWLAILWDLGGGYNDFNRETGNIKIFR WGFPGKNRKIEIGSRIQDIQSVRIDIKEGLNPRRALYLRVKGRRDIPLTRVGQPLSLAEL ETQGAQLARFLGVPLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTBL2 Human Gene Knockout Kit (CRISPR)
KN421858 1 Kit

ACTBL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PROX2 Human Gene Knockout Kit (CRISPR)
KN421365 1 Kit

PROX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (2C3), Biotin conjugate, 0.1mg/mL
BNCB1764-500 1x 500 µL

MMP9 (Matrix Metalloproteinase 9) (2C3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hsp90 beta Recombinant Rabbit monoclonal Antibody
HA750090 100 µL

Hsp90 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Gdf10 activation kit by CRISPRa
GA201580 1 Kit

Mouse Gdf10 activation kit by CRISPRa

Sign In for Pricing
View Details
Human C15orf65 activation kit by CRISPRa
GA115534 1 Kit

Human C15orf65 activation kit by CRISPRa

Sign In for Pricing
View Details