Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

This Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 24-221.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39

UniProt

Q759J5

Expression Region

24-221

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASKAPGSEDLPSAWKMVGVAVVSTLIFVQAAKSIDRSKPQTEFSEAEFEKVRSGLRRRVT VFKPDELEVLAVLADVPVEKIRAPAGARAVRVQQALERFRTDEHDKYHALLEELHAVHGD DYSAHLPKGALVALMGRYLKEVCQAGDSVVLLGFPRNMQEAIQFESEVAVISALVAPQGS EESQLVQYFKTVNKVITV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD2 Antibody[HIT11]
E-AB-F1311D-01 20 Tests

PE Anti-Human CD2 Antibody[HIT11]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[HIT11]
E-AB-F1311D-02 100 Tests

PE Anti-Human CD2 Antibody[HIT11]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[HIT11]
E-AB-F1311D-03 2x 100 Tests

PE Anti-Human CD2 Antibody[HIT11]

Sign In for Pricing
View Details
Cd200r1 Mouse Gene Knockout Kit (CRISPR)
KN502875 1 Kit

Cd200r1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p27 KIP 1 (CDKN1B) Rabbit Polyclonal Antibody
AP02674PU-N 100 µL

p27 KIP 1 (CDKN1B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fndc9 (N-term) Rabbit Polyclonal Antibody
AP46031PU-N 100 µL

Fndc9 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details