Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Uncharacterized protein RC0660 (RC0660)

This Recombinant Rickettsia conorii Uncharacterized protein RC0660 (RC0660) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Uncharacterized protein RC0660

UniProt

Q92HW0

Expression Region

1-198

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSSYKLRKKIWKSVYLLITVGILYIGYILIKSGYINEKNDINVTKKSLKDNKNFDLKYN IILKDSIFEGVNKNLNAYKIKTERAIKESNNKYKLDIINAIYNVNQDQTLIINAKEGFLD EESSILDLKNDVKLFFDEIIFNTNDARIDLVNKNITGHSPAKLLYKNSSITSDSFNTKDE NNIIIFKGNVSTIIDLSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRVI1 (IRAG1) (NM_001098579) Human Tagged ORF Clone Lentiviral Particle
RC220170L4V 200 µL

MRVI1 (IRAG1) (NM_001098579) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RANBP9 Rabbit Polyclonal Antibody
TA360315 100 µL

RANBP9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Acetyl-D-[2 13C]glucosamine
CS-T-47250 1 Each

N-Acetyl-D-[2 13C]glucosamine

Sign In for Pricing
View Details
HAT1 Antibody
MBS859887-01 0.05 mg

HAT1 Antibody

Sign In for Pricing
View Details
HAT1 Antibody
MBS859887-02 0.1 mg

HAT1 Antibody

Sign In for Pricing
View Details
HAT1 Antibody
MBS859887-03 0.1 mL (AF405L)

HAT1 Antibody

Sign In for Pricing
View Details