Recombinant Prochlorococcus marinus Photosystem I reaction center subunit XI (psaL)
This Recombinant Prochlorococcus marinus Photosystem I reaction center subunit XI (psaL) spans the amino acid sequence from region 1-199.
Product Specifications
Product Name Alternative
Photosystem I reaction center subunit XI, PSI subunit V, PSI-L
UniProt
A2BT95
Expression Region
1-199
Origin
Prochlorococcus marinus (strain AS9601)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSDFQKSFSESTSSIKFDEKYIDNSVQPNDIGVAEQWAVKTVADPCVGNLATPVNSGYFT KAFINNLPFYREGISPNFRGLETGAAFGYLLYGPFTMTGPLRNSEFALTAGLLAAIGAVH ILTALLVLYNAPGKAPNVQPPDATVNNPPKDLFTRAGWADFTSGFWLGGCGGSVFAWLLV GTLHLDTIMPIIKNIWTAG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402053-100 1x 100 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041424-500 1x 500 µL
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details