Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Protein-export membrane protein SecG (secG)

This Recombinant Helicobacter pylori Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

O25847

Expression Region

1-199

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSALLGLQIVLAVLIVVVVLLQKSSSIGLGAYSGSNESLFGAKGPASFMAKLTMFLGLL FVINTIALGYFYNKEYGKSVLDETKTNKELSPLVPATGTLNPALNPTLNPTLNPLEQAPT NPLMPQQTPNELPKEPAKTPSVESPKQNEKNEKNDAKENGIKGVEKTKENAKTPPTTHQK PKTHATQTNAHTNQKKDEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC16A 3'UTR Luciferase Stable Cell Line
TU012648 1.0 mL

LRRC16A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Semicircular Blocks, Acrylic
1110420/7 1 Each

Semicircular Blocks, Acrylic

Sign In for Pricing
View Details
MAP3K4 Polyclonal Antibody, Cy5 Conjugated
bs-11883R-Cy5 100 µL

MAP3K4 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
DEXI, CT (DEXI, MYLE, Dexamethasone-induced protein, Protein MYLE) (APC) discontinued
034594-APC 200 µL

DEXI, CT (DEXI, MYLE, Dexamethasone-induced protein, Protein MYLE) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Human SMARCB1 Protein, His, Yeast-1mg
QP7605-ye-1mg 1mg

Recombinant Human SMARCB1 Protein, His, Yeast-1mg

Sign In for Pricing
View Details
(3S) -3-Hydroxytetracosanoyl-CoA
orb3021724-01 10 mg

(3S) -3-Hydroxytetracosanoyl-CoA

Sign In for Pricing
View Details