Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Outer dense fiber protein 4 (ODF4)

This Recombinant Bovine Outer dense fiber protein 4 (ODF4) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Outer dense fiber protein 4, Outer dense fiber of sperm tails protein 4

UniProt

Q0II41

Expression Region

1-199

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIRSLERAGRAGKQDGVAVSPGQEEEVQNCVSTHDSNWPVIKDHSVKLHRVSPLLLQCR ITHSSRWIAQVLASELSLLAFILLVVMVFSKKWLCFERIRFYQHWTMNVTTKIYTSVHIM SLGLLHIYKSKSYSNSEWESFKLWTNHPAFGVAKITFCLALGLGIILTIWLHLPYIPGLQ KLPFFGWIGTVMSFCEGAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSS1 Rabbit Polyclonal Antibody
TA373217 100 µL

ACSS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human BTLA/CD272 Protein (His Tag)
PKSH033758-01 10 µg

Recombinant Human BTLA/CD272 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human BTLA/CD272 Protein (His Tag)
PKSH033758-02 50 µg

Recombinant Human BTLA/CD272 Protein (His Tag)

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF488A conjugate, 0.1mg/mL
BNC880280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR2L5 Antibody
8G556-AAT 50 µg

OR2L5 Antibody

Sign In for Pricing
View Details
FKBP5 Antibody
KC-2103-01 50 μL

FKBP5 Antibody

Sign In for Pricing
View Details