Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0284801 (DDB_G0284801)
This Recombinant Dictyostelium discoideum Putative uncharacterized transmembrane protein DDB_G0284801 (DDB_G0284801) spans the amino acid sequence from region 1-199.
Product Specifications
Product Name Alternative
Putative uncharacterized transmembrane protein DDB_G0284801
UniProt
Q54P44
Expression Region
1-199
Origin
Dictyostelium discoideum (Slime mold)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKFKRDENQNSTHHRGNKNNTNNDDDDKEEEEEIINDTTMPPLNNEEKYFLKKIFPFLPS RSSSSTSKLIFSLILDLVGFFTQIIPIFGFAFWPSISTYLIFKVYGSGLHLCVSFLEETI PGLGFIPTATCCWANEKYNIIPKVDRYLPTRYIKMVRNFISAFKKIAIAVALIAIYKIIS YFSPYLPFFGGSKNHQTSY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400050-500 1x 500 µL
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details