Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I reaction center subunit XI (psaL)

This Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I reaction center subunit XI (psaL) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Photosystem I reaction center subunit XI, PSI subunit V, PSI-L

UniProt

Q7UZX6

Expression Region

1-199

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDFQKSFSESTSSIKFDEKYIDNSVQPNDIGIANQWAVKPVSDPCVGNLATPVNSGYFT KAFINNLPFYREGISPNFRGLETGAAFGYLLYGPFSMTGPLRNSDFALTAGLLATIGAVH ILTGLLVLYNAPGKAPNVQPPDATVYNPPADLFTRTGWADFTSGFWLGGCGGAVFAWLLV GTLHLDTIMPIVKNIWTTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-500 1x 500 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-500 1x 500 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details