Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Cobalamin synthase (cobS)

This Recombinant Halobacterium salinarum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q9HPL2

Expression Region

1-199

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAGGVPHGTVAFAYLAVVFAVTGINHLDGVADAGDAAVVHGDPADRRTVLKDTTTGVGA IAAVVVVVAGLVTGSLGVAALPTWTAVGVVVATEVGAKTSMAAVACLAHAPHDGLGSQFT GNATPGALPAVAGVALPVALASVPSPAAAGALAGAVGAGALTRRWLTGLLGGANGDVFGA VNEVSRVVGLHAGVVVWTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Histone Deacetylase 9 (HDAC9) ELISA Kit
QY-E00036 96 Tests

Human Histone Deacetylase 9 (HDAC9) ELISA Kit

Sign In for Pricing
View Details
MTFMT Rabbit pAb, PE-Cy7 conjugated
orb2852521 100 µL

MTFMT Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
5-Bromo-7-nitroindoline
Q-1120.0005 5.0g

5-Bromo-7-nitroindoline

Sign In for Pricing
View Details
SNPH Protein Vector (Mouse) (pPM-C-His)
PV232281 500 ng

SNPH Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
THSD4 Protein Vector (Mouse) (pPM-C-His)
PV238209 500 ng

THSD4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
IL3RA Humanized Monoclonal Antibody
TA355195 100 µg

IL3RA Humanized Monoclonal Antibody

Sign In for Pricing
View Details